The domain within your query sequence starts at position 85 and ends at position 378; the E-value for the MRP-S31 domain shown below is 3.8e-118.
KKDLLDIIKDMKVDLSTANVKTPKPRGRKPSASLEATVDRLQKAPEDPPKKRNEFLSPEL VAAASAVADSLPFDKQTTKSELLRQLQQHEEELRAQKDREKRRISFTHIISNMKIAKSPS GRASTRPQHQIQFDEDMDSSLKQEKPTDFRKRKYLFKGKRLSIFADKAFADEPPEPEASP SLWEIEFAKQLASVADQPFENGFEEMIQWTKEGKLWEFPVNNEAGLDDDGSEFHEHIFLD KYLEDFPKQGPIRLFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRDILKE
MRP-S31 |
---|
PFAM accession number: | PF15433 |
---|---|
Interpro abstract (IPR026299): | Proteins in this family are components of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins [ (PUBMED:11279123) ]. This protein was previously identified as Imogen 38 (NP_065585) which is a 38kDa mitochondrial autoantigen associated with type 1 diabetes [ (PUBMED:8567980) ]. Its relationship to the etiology of this disease remains to be clarified. |
GO component: | mitochondrial small ribosomal subunit (GO:0005763) |
GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S31