The domain within your query sequence starts at position 45 and ends at position 142; the E-value for the MRP-S32 domain shown below is 6.8e-46.

QVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLE
QGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR

MRP-S32

MRP-S32
PFAM accession number:PF10210
Interpro abstract (IPR019346):

This entry represents a family of short proteins; each approximately 100 amino acid residues in length. They are identified as the mitochondrial 28S ribosomal proteins S32.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S32