The domain within your query sequence starts at position 61 and ends at position 187; the E-value for the MRP-S34 domain shown below is 5.3e-52.
ESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTF KGKSEDTAREIEQVMYHDWRLVPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQK NGDTSVQ
MRP-S34 |
---|
PFAM accession number: | PF16053 |
---|---|
Interpro abstract (IPR032053): | This entry represents ribosomal protein S34 from the mitochondrial 28S subunit [ (PUBMED:11279123) ]. |
GO component: | mitochondrion (GO:0005739) |
GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S34