The domain within your query sequence starts at position 61 and ends at position 187; the E-value for the MRP-S34 domain shown below is 5.3e-52.

ESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTF
KGKSEDTAREIEQVMYHDWRLVPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQK
NGDTSVQ

MRP-S34

MRP-S34
PFAM accession number:PF16053
Interpro abstract (IPR032053): This entry represents ribosomal protein S34 from the mitochondrial 28S subunit [(PUBMED:11279123)].
GO component:mitochondrion (GO:0005739)
GO function:structural constituent of ribosome (GO:0003735)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S34