The domain within your query sequence starts at position 9 and ends at position 196; the E-value for the MRVI1 domain shown below is 1.2e-74.
LRGVSQSAAENGADHLYSESPSQLREYLTQPSSEQTSSSESTVTSSESGSDILHMASGDL DCKPLCEKEEEARAASAMQGTSLAPAAYGDYTSVGVAKAASQLEAGEELRTTENGGKGSA PGETEISMPPKASVKLVNFQQSENTSANEKEVEAEFLRLSLGLKCDWFTLEKRVKLEERS RDLAEENL
MRVI1 |
---|
PFAM accession number: | PF05781 |
---|---|
Interpro abstract (IPR008677): | This family consists of mammalian MRVI1 proteins which are related to the lymphoid-restricted membrane protein (JAW1) and the IP3 receptor associated cGMP kinase substrates A and B (IRAGA and IRAGB). The function of MRVI1 is unknown although mutations in the Mrvi1 gene induces myeloid leukaemia by altering the expression of a gene important for myeloid cell growth and/or differentiation so it has been speculated that Mrvi1 is a tumour suppressor gene [ (PUBMED:10321731) ]. IRAG is very similar in sequence to MRVI1 and is an essential NO/cGKI-dependent regulator of IP3-induced calcium release. Activation of cGKI decreases IP3-stimulated elevations in intracellular calcium, induces smooth muscle relaxation and contributes to the antiproliferative and pro-apoptotic effects of NO/cGMP [ (PUBMED:10724174) [ (PUBMED:16990611) ]. Jaw1 is a member of a class of proteins with COOH-terminal hydrophobic membrane anchors and is structurally similar to proteins involved in vesicle targeting and fusion. This suggests that the function and/or the structure of the ER in lymphocytes may be modified by lymphoid-restricted resident ER proteins [ (PUBMED:8021504) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRVI1