The domain within your query sequence starts at position 46 and ends at position 381; the E-value for the MT domain shown below is 2.1e-41.
NRFYMGLSKILEATVLVTDMQEELLVIGPQIEQKAKEKEILMEKLRKDSQIVEKVQMLVK QDEEIVAEQVKIVEEYAQKTSNELKNVLPSLDKAIVALNALDKSDISELRVYTRPPYLVL TVMNAVCILLEKKPNWATAKLLLSDTSFLKRLINIDKDSIPDKVFLRLKKILNLPDFNPN KIAMVSVACCSMCQWVIALNNYHEVQKVVRPKQAQVAEAQNVLQIAKQRLLEKQRGLQLI EDHLQFLHTSYRDIVTEKHQLASRKKLATKRLQCASVLLTVLEDEKIRWQETINEIDCKL KGVCGDTFLSSACLAYIGVLTPEFRELVIQKWKDFC
MT |
---|
PFAM accession number: | PF12777 |
---|---|
Interpro abstract (IPR024743): | The 380kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380kDa motor unit contains a concatenated chain of six AAA modules (D1-6), of which four correspond to the ATP binding sites with P-loop signatures, and two are modules in which the P loop has been lost in evolution. This domain occurs between D4 and D5 and includes the two predicted alpha-helical coiled coil segments that form the stalk supporting the ATP-sensitive microtubule binding component [ (PUBMED:11250194) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MT