The domain within your query sequence starts at position 630 and ends at position 884; the E-value for the MTBP_C domain shown below is 1.3e-122.

PELSPGKLQVLPFEKASECHYHGIEYCLDDQKALERDGGFSELQSRLIRYETQTTCTRDS
FPVPTVLSPLPSPAVLSEPQSVPEGEALQGELRTEVSGLKRRSKDPSCLYPQKRLTRSES
SDCLPSQASCNSNHHHHTGKPRKPQAERCVSGLPLPGREASKDTSKTSSGQKRAHESKSS
KQMKESRSQKHTRMLKEVVKDTLKRHHITEAHESFTACSQRLFDISKFYLKDLKTSRGLF
EEMKKTANNNVVQVI

MTBP_C

MTBP_C
PFAM accession number:PF14920
Interpro abstract (IPR029418):

This entry represents the C-terminal domain of the MDM2-binding protein (MTBP). MDM2 is an E3 ubiquitin-protein ligase that mediates ubiquitination of p53, leading to its degradation by the proteasome [(PUBMED:14707283)]. MTBP inhibits autoubiquitination of MDM2, thereby enhancing MDM2 stability, and this promotes MDM2-mediated ubiquitination of p53 and its subsequent degradation [(PUBMED:15632057)]. Mouse MTBP also inhibits cancer cell migration by interacting with alpha-actinin-4 (ACTN4) [(PUBMED:22370640)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTBP_C