The domain within your query sequence starts at position 11 and ends at position 149; the E-value for the MTP18 domain shown below is 1.2e-22.

RDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKAGEVPSPE
AGRNTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPTVRKWTTTTLG
LLAIPVIIHPIDRSVDFLL

MTP18

• PFAM accession number: PF10558
• Interpro abstract (IPR019560):

  This family of proteins are mitochondrial 18kDa proteins that are often misannotated as carbonic anhydrases. It was shown that knockdown of MTP18 protein results in a cytochrome c release from mitochondria and consequently leads to apoptosis [ (PUBMED:15155745) ]. Over expression studies suggest that MTP18 is required for mitochondrial fission [ (PUBMED:15985469) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTP18