The domain within your query sequence starts at position 129 and ends at position 229; the E-value for the MTS domain shown below is 5.4e-6.
TFRISPHAFFQVNTPAAEVLYTVIQEWAQLDGGSTVLDVCCGTGTIGLALAPKVKRVVGI ELCQEAVEDARMNALTNELSNVEFHCGRAEDLVPGLVSRLS
MTS |
---|
PFAM accession number: | PF05175 |
---|---|
Interpro abstract (IPR007848): | This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTS