The domain within your query sequence starts at position 170 and ends at position 299; the E-value for the MTS domain shown below is 2.5e-9.

TGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKS
NNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPT
IGDVHLAPFT

MTS

MTS
PFAM accession number:PF05175
Interpro abstract (IPR007848): This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases.
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTS