The domain within your query sequence starts at position 389 and ends at position 489; the E-value for the MTS domain shown below is 6.2e-9.

GLTFRISPHAFFQVNTPAAEVLYTVIQEWAQLDGGSTVLDVCCGTGTIGLALAPKVKRVV
GIELCQEAVEDARMNALTNELSNVEFHCGRAEDLVPGLVSR

MTS

MTS
PFAM accession number:PF05175
Interpro abstract (IPR007848): This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases.
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTS