The domain within your query sequence starts at position 6 and ends at position 85; the E-value for the MYCBPAP domain shown below is 2.3e-19.
TLHHKQLPGECETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAYLTEEDLFNYRNP RLHYQHQVVQNLHQLWQQYR
MYCBPAP |
 |
|---|
| PFAM accession number: | PF14646 |
|---|---|
| Interpro abstract (IPR032707): | This family includes the human MYCBP-associated protein (MYCBPAP) and its homologues from other eukaryotes. Mammalian MYCBPAP proteins may be involved in synaptic processes [ (PUBMED:15607946) ] and may have a role in spermatogenesis [ (PUBMED:12151104) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MYCBPAP