The domain within your query sequence starts at position 6 and ends at position 85; the E-value for the MYCBPAP domain shown below is 2.3e-19.

TLHHKQLPGECETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAYLTEEDLFNYRNP
RLHYQHQVVQNLHQLWQQYR

MYCBPAP

MYCBPAP
PFAM accession number:PF14646
Interpro abstract (IPR032707):

This family includes the human MYCBP-associated protein (MYCBPAP) and its homologues from other eukaryotes. Mammalian MYCBPAP proteins may be involved in synaptic processes [(PUBMED:15607946)] and may have a role in spermatogenesis [(PUBMED:12151104)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MYCBPAP