The domain within your query sequence starts at position 48 and ends at position 99; the E-value for the MYEOV2 domain shown below is 2e-24.

AQEGGGQSQLYCETHPQAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDV

MYEOV2

MYEOV2
PFAM accession number:PF15004
Interpro abstract (IPR029391):

This entry includes COP9 signalosome complex subunit 9, a component of the COP9 signalosome complex (CSN), which is conserved in all eukaryotes. The CSN complex is an essential regulator of the largest family of E3 ubiquitin ligases, the cullin-RING-ubiquitin ligases (CRLs). The CSN complex deactivates CRL by removing the ubiquitin-like tag NEDD8 (deneddylation) from the cullin subunit, or by binding to the deneddylated CRL, and preventing it interacting with E2 enzymes and ubiquitination substrates [ (PUBMED:26456823) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MYEOV2