The domain within your query sequence starts at position 604 and ends at position 660; the E-value for the MYT1 domain shown below is 2e-28.

YRPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFQC

MYT1

MYT1
PFAM accession number:PF08474
Interpro abstract (IPR013681):

This domain is found in the myelin transcription factor 1 (MYT1) of chordates. MYT1 contains C2HC zinc finger domains (IPR002515) and is expressed in developing neurons of the central nervous system [(PUBMED:9373037)] where it is involved in the selection of neuronal precursor cells [(PUBMED:8980226)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MYT1