The domain within your query sequence starts at position 1232 and ends at position 1459; the E-value for the M_domain domain shown below is 6.8e-77.

NQDGGLVEEPTTSPFLPSPSLKLPLSNSALPSQALGGVASGLGMQNLNSSRQIPSGNLGV
FGNSGAAQARTMQQPPVQPLNSSQPSLRAQVPQFLSPQVQAQLLQFAAKNIGLSPALLTS
PINPQHMTMLNQLYQLQLAYQRLQIQQQMLQAQRNVSGPMRQQEQQVARTITNLQQQIQQ
HQRQLAQALLVKQPPPPPPPPHLSLHPSAGKSGMESFPPPPQAPGLPD

M_domain

M_domain
PFAM accession number:PF12938
Interpro abstract (IPR026805): This entry represents the M (middle region) domain of GW182 [(PUBMED:19304925)]. GW182 (also known as Gawky) plays a role in RNA-mediated gene silencing by micro-RNAs (miRNAs) [(PUBMED:16177138), (PUBMED:19304924)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry M_domain