The domain within your query sequence starts at position 2 and ends at position 157; the E-value for the Macoilin domain shown below is 2.1e-112.

KRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLF
IRSVYDSFRYQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVC
LPTVSLWILFVYIEAAIRFKDLKNFHVDLCRPFAAH

Macoilin

Macoilin
PFAM accession number:PF09726
Interpro abstract (IPR019130):

Macoilin has several highly conserved predicted transmembrane domains towards the N terminus and the coiled-coil regions at the C terminus. It is a conserved nervous system-specific ER membrane protein that regulates neuronal functions [(PUBMED:21437263), (PUBMED:21589894)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Macoilin