The domain within your query sequence starts at position 125 and ends at position 173; the E-value for the Macscav_rec domain shown below is 1.5e-28.
MEERIESISNSKADLIDTERFQNFSMATDQRLNDILLQLNSLISSVQEH
Macscav_rec |
 |
|---|
| PFAM accession number: | PF03523 |
|---|---|
| Interpro abstract (IPR003543): | The egg peptide speract receptor is a transmembrane glycoprotein of about 500 amino acids [ (PUBMED:2538832) ]. Topologically, it comprises a large extracellular domain of about 450 residues, followed by a transmembrane domain and a short cytoplasmic region of about 12 amino acids. The extracellular domain contains 4 repeats of a well-conserved region, which spans 115 amino acids and contains 6 conserved cysteines. A similar domain is also found towards the C terminus of macrophage scavenger receptor type I [ (PUBMED:1978939) ], a membrane glycoprotein implicated in the pathologic deposition of cholesterol in arterial walls during artherogenesis, and in the CD5 glycoprotein, which acts as a receptor in regulating T-cell proliferation. The type I and type II human scavenger receptors are similar to their bovine, rabbit and murine counterparts. They consist of 6 domains: cytoplasmic (I); membrane-spanning (II); spacer (III); alpha-helical coiled- coil (IV); collagen-like (V); and a type-specific C-terminal (VI) [ (PUBMED:2251254) ]. Immunohistochemical studies have indicated the presence of scavenger receptors in the macrophages of lipid-rich atherosclerotic lesions, suggesting the involvement of these receptors in atherogenesis [ (PUBMED:2251254) ]. The macrophage scavenger receptor is trimeric and has unusual ligand-binding properties [ (PUBMED:2300204) ]. The trimeric structure of the bovine type I scavenger receptor contains 3 extracellular C-terminal cysteine-rich domains connected to the transmembrane domain by a long fibrous stalk. The stalk structure, which consists of an alpha-helical coiled coil and a collagen-like triple helix, has not previously been observed in an integral membrane protein [ (PUBMED:2300204) ]. |
| GO process: | receptor-mediated endocytosis (GO:0006898) |
| GO component: | membrane (GO:0016020) |
| GO function: | scavenger receptor activity (GO:0005044) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Macscav_rec