The domain within your query sequence starts at position 84 and ends at position 202; the E-value for the Maf1 domain shown below is 4.3e-37.

LSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVRED

Maf1

Maf1
PFAM accession number:PF09174
Interpro abstract (IPR015257):

Maf1 is a negative regulator of RNA polymerase III [(PUBMED:11438659), (PUBMED:16762835)]. It inhibits the de novo assembly of TFIIIB onto DNA [(PUBMED:17785443)]. Maf1 represses Pol III in response to DNA damage, oxidative stress, growth to stationary phase, treatment with rapamycin or chlorpromazine, and blocking of the secretory pathway [(PUBMED:15196897)]. It targets the initiation factor TFIIIB [(PUBMED:12504022)]. Its structure has been solved [(PUBMED:20887893)].

GO process:negative regulation of transcription by RNA polymerase III (GO:0016480)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Maf1