The domain within your query sequence starts at position 67 and ends at position 102; the E-value for the Maf_N domain shown below is 2e-15.

PGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQ

Maf_N

Maf_N
PFAM accession number:PF08383
Interpro abstract (IPR013592):

This region is found in various leucine zipper transcription factors of the Maf family. These are implicated in the regulation of insulin gene expression [(PUBMED:12368292)], in erythroid differentiation [(PUBMED:8620536)], and in differentiation of the neuroretina [(PUBMED:11416124)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Maf_N