The domain within your query sequence starts at position 5 and ends at position 146; the E-value for the Mago_nashi domain shown below is 7.5e-84.

FYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRII
DDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYY
LVQDLKCLVFSLIGLHFKIKPI

Mago_nashi

Mago_nashi
PFAM accession number:PF02792
Interpro abstract (IPR004023):

This family was originally identified in Drosophila and called mago nashi, it is a strict maternal effect, grandchildless-like, gene [(PUBMED:1765008)]. The protein is an integral member of the exon junction complex (EJC). The EJC is a multiprotein complex that is deposited on spliced mRNAs after intron removal at a conserved position upstream of the exon-exon junction, and transported to the cytoplasm where it has been shown to influence translation, surveillance, and localization of the spliced mRNA. It consists of four core proteins (eIF4AIII, Barentsz [Btz], Mago, and Y14), mRNA, and ATP and is supposed to be a binding platform for more peripherally and transiently associated factors along mRNA travel. Mago and Y14 form a stable heterodimer that stabilizes the complex by inhibiting eIF4AIII's ATPase activity. Mago-Y14 heterodimer has been shown to interact with the cytoplasmic protein PYM, an EJC disassembly factor, and specifically binds to the karyopherin nuclear receptor importin 13 [(PUBMED:18164611), (PUBMED:20818392), (PUBMED:20946982), (PUBMED:15734573), (PUBMED:12781131), (PUBMED:15145352), (PUBMED:18423193), (PUBMED:1765008), (PUBMED:10656761), (PUBMED:10662555), (PUBMED:11707413), (PUBMED:9272960), (PUBMED:12730685), (PUBMED:14968132), (PUBMED:15567724), (PUBMED:16380844), (PUBMED:17545126)].

The human homologue has been shown to interact with an RNA binding protein, ribonucleoprotein rbm8 (Q9Y5S9) [(PUBMED:10662555)]. An RNAi knockout of the Caenorhabditis elegans homologue causes masculinization of the germ line (Mog phenotype) hermaphrodites, suggesting it is involved in hermaphrodite germ-line sex determination [(PUBMED:10656761)] but the protein is also found in hermaphrodites and other organisms without a sexual differentiation.

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mago_nashi