The domain within your query sequence starts at position 1 and ends at position 119; the E-value for the Mak10 domain shown below is 1.9e-37.

VNRKVLNFEQAIKDGTIKIKDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNP
DFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGML

Mak10

Mak10
PFAM accession number:PF04112
Interpro abstract (IPR007244):

NatC N(alpha)-terminal acetyltransferases contain Mak10p, Mak31p and Mak3p subunits. All three subunits are associated with each other to form the active complex [(PUBMED:11274203)], which regulates embryonic growth control and vessel development [(PUBMED:16484612)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mak10