The domain within your query sequence starts at position 40 and ends at position 193; the E-value for the Mak10 domain shown below is 1.2e-55.

KLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLP
ELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREK
VNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGML

Mak10

Mak10
PFAM accession number:PF04112
Interpro abstract (IPR007244):

In budding yeasts, NatC N(alpha)-terminal acetyltransferases contain Mak10, Mak31 and Mak3 subunits. All three subunits are associated with each other to form the active complex [ (PUBMED:11274203) ].

Human Naa35 is an auxillary component of the NatC complex which catalyzes acetylation of N-terminal methionine residues. It is involved in regulation of apoptosis and proliferation of smooth muscle cells [ (PUBMED:19398576) ].

GO process:N-terminal peptidyl-methionine acetylation (GO:0017196)
GO component:NatC complex (GO:0031417)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mak10