The domain within your query sequence starts at position 45 and ends at position 145; the E-value for the Mak10 domain shown below is 2.2e-29.
LGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPE LIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPA
Mak10 |
---|
PFAM accession number: | PF04112 |
---|---|
Interpro abstract (IPR007244): | In budding yeasts, NatC N(alpha)-terminal acetyltransferases contain Mak10, Mak31 and Mak3 subunits. All three subunits are associated with each other to form the active complex [ (PUBMED:11274203) ]. Human Naa35 is an auxillary component of the NatC complex which catalyzes acetylation of N-terminal methionine residues. It is involved in regulation of apoptosis and proliferation of smooth muscle cells [ (PUBMED:19398576) ]. |
GO process: | N-terminal peptidyl-methionine acetylation (GO:0017196) |
GO component: | NatC complex (GO:0031417) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mak10