The domain within your query sequence starts at position 138 and ends at position 235; the E-value for the Mak16 domain shown below is 4.7e-36.
SKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEKQEAES DSEDEEEEEDEDEEEDVGKREFVEDEEVEESDLSDFED
Mak16 |
 |
|---|
| PFAM accession number: | PF04874 |
|---|---|
| Interpro abstract (IPR006958): | In budding yeasts, Mak16 forms part of the 66S pre-ribosomal particles and functions as a transacting actor involved in rRNA processing [ (PUBMED:7739558) (PUBMED:16710831) ]. The Schistosoma mansoni (Blood fluke) Mak16 has been shown to target protein transport to the nucleolus [ (PUBMED:10838225) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mak16