The domain within your query sequence starts at position 140 and ends at position 408; the E-value for the Mannosyl_trans domain shown below is 9.8e-113.
VSSRGNADSIVASLVLSTLYFIEKRLIACAAVFYGFAVHMKMYPVTYILPIALHLRPERD DDERLRQARFSFQARLYDFLRRLCSWAVLLFVAVAGLTFVALSFGFYYKYGWEFLEHTYF YHLTRRDIRHNFSPYFYMLYLTAESKWSFTLGIAAFLPQFILLSAASFAYYRDLVFCCFL HTSIFVTFNKVCTSQYFLWYLCLLPLVMPLVRMPWKRAVVLLLFWFIGQALWLAPAYVLE FQGKNTFLFIWLAGLFFLLINCSILIQII
Mannosyl_trans |
---|
PFAM accession number: | PF05007 |
---|---|
Interpro abstract (IPR007704): | PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilise nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates [ (PUBMED:11226175) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | glycolipid mannosyltransferase activity (GO:0004376), alpha-1,4-mannosyltransferase activity (GO:0051751) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mannosyl_trans