The domain within your query sequence starts at position 10 and ends at position 119; the E-value for the Mannosyl_trans2 domain shown below is 2.7e-22.
EVLRFAVNCRILTLVLQVLTRFLASSTPIMYWFPAHLLQDQEPLLRCVDTEPGKLPQEKS PPGQKAPRNCLMKLFYDWKRCSPVTRCVLVYFLTYWLLGLILHCNFLPWT
Mannosyl_trans2 |
---|
PFAM accession number: | PF04188 |
---|---|
Interpro abstract (IPR007315): | This entry represents GPI mannosyltransferase 2, also known as PIG-V in humans or Gpi18 in fungi. PIG-V is a mannosyltransferase that transfers the second mannose in glycosylphosphatidylinositol (GPI) biosynthesis [ (PUBMED:15623507) (PUBMED:15720390) (PUBMED:17615295) ]. GPI is a glycolipid that anchors many proteins to the eukaryotic cell surface [ (PUBMED:15623507) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
GO function: | glycolipid mannosyltransferase activity (GO:0004376), alpha-1,6-mannosyltransferase activity (GO:0000009) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mannosyl_trans2