The domain within your query sequence starts at position 346 and ends at position 451; the E-value for the MaoC_dehydrat_N domain shown below is 1.4e-8.

YALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALH
GEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKE

MaoC_dehydrat_N

MaoC_dehydrat_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MaoC_dehydrat_N