The domain within your query sequence starts at position 479 and ends at position 600; the E-value for the MaoC_dehydratas domain shown below is 1.8e-41.

AAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGF
SARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVIS
NA

MaoC_dehydratas

MaoC_dehydratas
PFAM accession number:PF01575
Interpro abstract (IPR002539):

The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase [(PUBMED:1556068)]. The MaoC protein shares similarity with a region found in a wide variety of enzymes, such as peroxisomal hydratase-dehydrogenase-epimerase and fatty acid synthase beta subunit. A deletion mutant of the C-terminal 271 amino acids in peroxisomal hydratase-dehydrogenase-epimerase (Q02207), corresponding to the MaoC domain, abolished its 2-enoyl-CoA hydratase activity, suggesting that this region may be a hydratase enzyme [(PUBMED:1551874)]. Several bacterial proteins that are composed solely of this domain have (R)-specific enoyl-CoA hydratase activity [(PUBMED:9457873)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MaoC_dehydratas