The domain within your query sequence starts at position 53 and ends at position 213; the E-value for the MatE domain shown below is 3.5e-32.

PVFLAQLMIFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQS
FGGKNLKRVGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIP
ALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAF

MatE

MatE
PFAM accession number:PF01554
Interpro abstract (IPR002528):

Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters. These proteins mediate resistance to a wide range of cationic dyes, fluroquinolones, aminoglycosides and other structurally diverse antibodies and drugs. MATE proteins are found in bacteria, archaea and eukaryotes. These proteins are predicted to have 12 alpha-helical transmembrane regions, some of the animal proteins may have an additional C-terminal helix [(PUBMED:12603313)].

GO process:transmembrane transport (GO:0055085), drug transmembrane transport (GO:0006855)
GO component:membrane (GO:0016020)
GO function:antiporter activity (GO:0015297), drug transmembrane transporter activity (GO:0015238)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MatE