The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the Med23 domain shown below is 4.4e-14.

YAMERSETEEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKC

Med23

Med23
PFAM accession number:PF11573
Interpro abstract (IPR021629):

Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med23