The domain within your query sequence starts at position 657 and ends at position 745; the E-value for the Med25_NR-box domain shown below is 5.3e-43.
TGVPPPQASLHHLQPPGAPTLLPPHQSMGQPQLGPQLLHPPPAQSWPTQLPQRAPLPGQM LLSGGPRGPVPQPGLQPSVMEDDILMDLI
Med25_NR-box |
---|
PFAM accession number: | PF11244 |
---|---|
Interpro abstract (IPR021406): | The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA, domain, an SD1 - synapsin 1 - domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and this C-terminal NR box-containing domain (646-650) from C69-747. The NR box of MED25 is critical for its recruitment to the promoter, probably through an interaction with pre bound RAR [ (PUBMED:17641689) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med25_NR-box