The domain within your query sequence starts at position 228 and ends at position 383; the E-value for the Med25_SD1 domain shown below is 5.8e-55.
LPVGGSSTSGSLQTKQAVPLPPAPASAATLSAAPPQALPPVPPQYQVPGNLSAAQVAAQN AVEAAKSQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLAPVPPGAPKPPPASQPSLV STVAPGPVLAAPAQPGAPSLAGTVTPGGVNGPSAAQ
Med25_SD1 |
---|
PFAM accession number: | PF11235 |
---|---|
Interpro abstract (IPR021397): | The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA, domain, this SD1 - synapsin 1 - domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This The function of the SD domains is unclear [ (PUBMED:17641689) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med25_SD1