The domain within your query sequence starts at position 407 and ends at position 586; the E-value for the Med26_C domain shown below is 5.1e-91.

RLKERKLTFDPMTRQIRPLTQKEPVRADSPVPTEQLPRTELEQQEVKASLQSPFEQTNWK
ELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMAEYLKQEESSRQGARQPHVLLPLPTPT
DLPGLTREVTQDDLDRIQAQQWPGVNGCEDTQGNWYDWTQCISLDPHGDDGRLNILPYVC

Med26_C

Med26_C
PFAM accession number:PF15693
Interpro abstract (IPR031416):

This entry represents the C-terminal domain of subunit 26 of the Mediator complex in eukaryotes (Med26). Med19 and Med26 act synergistically to mediate the interaction between Mediator and REST, a Kruppel-type zinc finger transcription factor that binds to a 21-bp RE1 silencing element present in over 900 human genes [(PUBMED:19049968)]. The C-terminal domain is critical and sufficient for its assembly into Mediator and its interaction with Pol II. The most highly conserved C-terminal amino acids are critical for these interactions because deletion of the last eight amino acids from the Med26 C terminus disrupted binding to Mediator and Pol II [(PUBMED:21729782)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med26_C