The domain within your query sequence starts at position 15 and ends at position 109; the E-value for the Med31 domain shown below is 2.7e-43.
RLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLH MLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYS
Med31 |
---|
PFAM accession number: | PF05669 |
---|---|
Interpro abstract (IPR008831): | This entry includes subunit Med31 of the Mediator complex and the Saccharomyces cerevisiae homologue, Soh1. Soh1 is responsible for the repression of temperature sensitive growth of the Hpr1 mutant [ (PUBMED:7982575) ] and has been found to be a component of the RNA polymerase II transcription complex. Soh1 not only interacts with factors involved in DNA repair, but transcription as well. Thus, the Soh1 protein may serve to couple these two processes [ (PUBMED:8849885) ]. The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins. The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.
Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | mediator complex (GO:0016592) |
GO function: | transcription coregulator activity (GO:0003712) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med31