The domain within your query sequence starts at position 1 and ends at position 306; the E-value for the Mei4 domain shown below is 3.8e-112.

MDIQPWYLKTSKLALALAIIHSKPADRSSREYTEYLASLVTQKESTWKSKLEALEAEVLQ
LRQKLLLSRISSGLFKNGPDVLPTLSDQEPTSSENTLTLMDDSGCVLSNEQRNEPAELSQ
HFVESTDPPLLPLPLEKRPRTTLENPLSSHMQFFQHLLELKKWTESSSLKVYLTHFEKDS
STVSDSVSQLLDALITFYRNPKLPFSSFWTEAVGTLARLASDFNLSNHIFKRCSKKLEEF
EKTLLQAILENNSINRFQVQRYVSQSLVTLGSCSLLRKSIISLLLSEVNSFVDDLGAIDQ
ALPVEL

Mei4

Mei4
PFAM accession number:PF13971
Interpro abstract (IPR025888):

Meiosis-specific protein MEI4 is required for meiotic induction of recombination, viable spore production and chromosome synapsis. It is a component of the MER2-MEI4-REC114 complex which seems to be required for meiotic double-strand break (DSB) formation [(PUBMED:16783010), (PUBMED:20551173)]. In Schizosaccharomyces pombe it is known as Rec24 [(PUBMED:16303567), (PUBMED:21429938)].

GO process:meiotic DNA double-strand break formation (GO:0042138), DNA recombination (GO:0006310)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mei4