The domain within your query sequence starts at position 11 and ends at position 86; the E-value for the Meiosis_expr domain shown below is 6.3e-43.

ISRAKKWSEEIENLYRFQQAGYRDEIEYKQVKQVAMVDRWPETGYVKKLQRRDNTFFYYN
KERECEDKEVHKVKVY

Meiosis_expr

Meiosis_expr
PFAM accession number:PF15163
Interpro abstract (IPR020186):

This entry represents Meiosis-expressed gene 1 protein and its homologues, encoded by the gene MEIG1. It may be involved in germ cell differentiation during meiotic prophase. Sequence analysis predicts this protein to be 10.8kDa in size and to be highly charged and lysine rich [(PUBMED:1390336)].

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Meiosis_expr