The domain within your query sequence starts at position 108 and ends at position 192; the E-value for the Meis_PKNOX_N domain shown below is 5.5e-48.
GGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCD NFCHRYISCLKGKMPIDLVIDDREG
Meis_PKNOX_N |
 |
|---|
| PFAM accession number: | PF16493 |
|---|---|
| Interpro abstract (IPR032453): | This domain is found towards the N terminus of the TALE/MEIS homeobox family members, including homeobox protein PKNOX and Meis. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Meis_PKNOX_N