The domain within your query sequence starts at position 70 and ends at position 141; the E-value for the Melibiase domain shown below is 1.5e-5.

LFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANYVHSK
GLKLGIYADVGN

Melibiase

Melibiase
PFAM accession number:PF02065
Interpro abstract (IPR002252):

O-Glycosyl hydrolases (EC 3.2.1.) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [(PUBMED:7624375), (PUBMED:8535779)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.

Glycoside hydrolase family 36 occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase [(PUBMED:12123797), (PUBMED:20681989)]. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate [(PUBMED:20681989)]. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

Proteins in this entry also include AgaSK, a bifunctional protein that contains two domains: one closely related to alpha-galactosidases from glycoside hydrolase family GH36 and the other containing a nucleotide-binding motif. It can hydrolyze melibiose and raffinose to galactose and either glucose or sucrose, respectively, and can specifically phosphorylate sucrose on the C6 position of glucose in the presence of ATP [(PUBMED:21931163)].

GO process:carbohydrate metabolic process (GO:0005975)
GO function:alpha-galactosidase activity (GO:0004557)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Melibiase