The domain within your query sequence starts at position 4 and ends at position 101; the E-value for the Membralin domain shown below is 1.6e-44.
NPLINVRDRLFHALFFKMAVTYSRLFPPAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSP INCLEHVRDRWPREGVLRVEVRHNSSRAPVILQFCDGG
Membralin |
---|
PFAM accession number: | PF09746 |
---|---|
Interpro abstract (IPR019144): | Membralin is evolutionarily highly conserved, though it appears to represent a unique protein family. The protein appears to contain several transmembrane regions. In humans it is expressed in certain cancers, particularly ovarian cancers [ (PUBMED:16084606) ]. Membralin-like gene homologues have been identified in plants including grape, cotton and tomato [ (PUBMED:12638133) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Membralin