The domain within your query sequence starts at position 536 and ends at position 615; the E-value for the Menin domain shown below is 4.9e-26.

QEVGNAAQAPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMK
KQKVSTPSDYTLSFLKRQRK

Menin

Menin
PFAM accession number:PF05053
Interpro abstract (IPR007747): The tumour suppressor gene MEN1 is mutated in patients with a dominantly inherited tumour syndrome, multiple endocrine neoplasia type 1 (MEN1) [(PUBMED:12145286)]. The MEN1 gene encodes a protein known as Menin, which is located predominantly in the nucleus. Menin has been shown to interact with the mixed lineage leukemia (MLL) protein, a histone H3 lysine 4 methyltransferase, and plays a critical role in hematopoiesis and leukemogenesis [(PUBMED:21740816)].
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Menin