The domain within your query sequence starts at position 1 and ends at position 624; the E-value for the Mesothelin domain shown below is < 1e-12.

MALPTARPLLGSCGSPICSRSFLLLLLSLGWIPRLQTQTTKTSQEATLLHAVNGAADFAS
LPTGLFLGLTCEEVSDLSMEQAKGLAMAVRQKNITLRGHQLRCLARRLPRHLTDEELNAL
PLDLLLFLNPAMFPGQQACAHFFSLISKANVDVLPRRSLERQRLLMEALKCQGVYGFQVS
EADVRALGGLACDLPGKFVARSSEVLLPWLAGCQGPLDQSQEKAVREVLRSGRTQYGPPS
KWSVSTLDALQSLVAVLDESIVQSIPKDVKAEWLQHISRDPSRLGSKLTVIHPRFRRDAE
QKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDK
TYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACY
LRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQ
KACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAE
VQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
SRASLLGPGFVLIWIPALLPALRL

Mesothelin

Mesothelin
PFAM accession number:PF06060
Interpro abstract (IPR010335):

This family consists of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known [(PUBMED:10733593),(PUBMED:10500211)]. This protein is predicted have superhelical structures with ARM-type repeats which suggests that it may act as superhelical lectins to bind the carbohydrate moieties of extracellular glycoproteins [(PUBMED:19128473)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mesothelin