The domain within your query sequence starts at position 68 and ends at position 308; the E-value for the Metallophos domain shown below is 3.3e-13.

LKAMFLADTHLLGEIRGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSSD
QAWADDVQRFQRMFRHDSHVQLKVVIGNHDVGFHYQMSKYRIKRFEKVFGSERLLSLKGV
NFVMVNSVAMEGDGCIICSEEEAELREISRKLNCSQEQVPGSSQCDREPEPRLPLSAPVL
LQHYPLYRASDANCSGEDAAPPEERNVPFEEKYDVLSREASQKLLWWLRPRLVLSGHTHS
A

Metallophos

Metallophos
PFAM accession number:PF00149
Interpro abstract (IPR004843):

This domain is found in a diverse range of phosphoesterases [(PUBMED:9685491)], including bis(5'-nucleosyl)-tetraphosphatase (apaH), nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or archaeal/yeast Mre11. The most conserved regions in this domain centre around the metal chelating residues.

GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Metallophos