The domain within your query sequence starts at position 420 and ends at position 482; the E-value for the Metallophos_C domain shown below is 4.5e-22.

GPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKI
VDD

Metallophos_C

Metallophos_C
PFAM accession number:PF14008
Interpro abstract (IPR025733):

This domain is found at the C terminus of purple acid phosphatase proteins [(PUBMED:12021284)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Metallophos_C