The domain within your query sequence starts at position 268 and ends at position 359; the E-value for the Methyltr_RsmF_N domain shown below is 2.9e-12.

FLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQALINRGVNLDPLGKWS
KSGLVVYDSSVPIGATPEYLAGHYMLQGASSM

Methyltr_RsmF_N

Methyltr_RsmF_N
PFAM accession number:PF17125
Interpro abstract (IPR031341):

This is the N-terminal domain of the RsmF methyl transferase. RsmF is a multi-site-specific methyltransferase that is responsible for the synthesis of three modifications on cytidines in 16S ribosomal RNA. The N terminus is critical for stabilising the catalytic core of the enzyme [(PUBMED:16793063), (PUBMED:20558545)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltr_RsmF_N