The domain within your query sequence starts at position 276 and ends at position 331; the E-value for the Methyltransf_10 domain shown below is 5.5e-21.

FRIIISFRWYSCMLGKKCSLAPLKEELRIQGVPKVTFTEFCQGRTMRWALAWSFYD

Methyltransf_10

Methyltransf_10
PFAM accession number:PF05971
Interpro abstract (IPR010286):

Ribosomal RNA large subunit methyltransferase F methylates the adenine in position 1618 of 23S rRNA [(PUBMED:18021804)]. It belongs to the METT10D/rlmF family.

This entry represents ribosomal RNA large subunit methyltransferase F, and related proteins. These include methyltransferase-like protein 16, which is a U6 snRNA m6A methyltransferase [(PUBMED:28525753)], and psilocybin synthase (PsiM), which is a methyltransferase involved in the biosynthesis of the psychotropic agent psilocybin from the mushroom Psilocybe cubensis [(PUBMED:28763571)].

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_10