The domain within your query sequence starts at position 84 and ends at position 189; the E-value for the Methyltransf_11 domain shown below is 2.8e-8.
LDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTK LSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLI
Methyltransf_11 |
---|
PFAM accession number: | PF08241 |
---|---|
Interpro abstract (IPR013216): | Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to:
|
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_11