The domain within your query sequence starts at position 52 and ends at position 179; the E-value for the Methyltransf_15 domain shown below is 1.1e-9.
NKAVADLGCGCGVLSIGAAMLGAGLCVGFDIDEDALEIFNKNVEEFELTNVDMIQCDVYS LSNRMSKLFDTVIMNPPFGTKNNKGTDMAFLKTALGMARTAVYSLHKSSTREHIQKKAAE WKVKIEII
Methyltransf_15 |
![]() |
---|
PFAM accession number: | PF09445 |
---|---|
Interpro abstract (IPR019012): | RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [ (PUBMED:17284461) (PUBMED:18840651) (PUBMED:15590684) ]. Trimethylguanosine synthase is specific for guanine, and N7 methylation must precede N2 methylation. This enzyme is required for pre-mRNA splicing, pre-rRNA processing and small ribosomal subunit synthesis. As such, this enzyme plays a role in transcriptional regulation. |
GO process: | RNA methylation (GO:0001510), 7-methylguanosine RNA capping (GO:0009452) |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_15