The domain within your query sequence starts at position 35 and ends at position 198; the E-value for the Methyltransf_16 domain shown below is 4.4e-39.
FCGHELSITQNFGSRLGVAARVWDAALSLCDYFESQNVDFRGKKVIELGAGTGIVGILAA LQGGDVTITDLPVALEQIQDNVHANVPPGGRARVCALSWGIDQHVFPGNYDLVLGADIVY LEPTFPLLLGTLRHLCGPHGTIYLASKMRAEHGAETFFRRLLPQ
Methyltransf_16 |
---|
PFAM accession number: | PF10294 |
---|---|
Interpro abstract (IPR019410): | This entry represents a group of lysine methyltransferases. Characterised members of this family are protein methyltransferases targetting Lys residues in specific proteins, including calmodulin, VCP, Kin17 and Hsp70 proteins [ (PUBMED:20975703) (PUBMED:22948820) (PUBMED:23349634) (PUBMED:23921388) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_16