The domain within your query sequence starts at position 86 and ends at position 218; the E-value for the Methyltransf_16 domain shown below is 1.9e-10.

WAIYWPGGQALSRYLLDNPAVVRGKSVLDLGSGCGATAIAAKMSGASKILANDIDPIAGM
AITLNCKLNGLNPFPVLTKNILNTQQGKFDLIVLGDMFYDEDLADSLHLWLQNYFWTHGT
RVLIGDPGRPQFS

Methyltransf_16

Methyltransf_16
PFAM accession number:PF10294
Interpro abstract (IPR019410):

This entry represents a group of lysine methyltransferases. Characterised members of this family are protein methyltransferases targetting Lys residues in specific proteins, including calmodulin, VCP, Kin17 and Hsp70 proteins [(PUBMED:20975703), (PUBMED:22948820), (PUBMED:23349634), (PUBMED:23921388)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_16