The domain within your query sequence starts at position 70 and ends at position 177; the E-value for the Methyltransf_18 domain shown below is 1.1e-9.

KDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVE
EVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDR

Methyltransf_18

Methyltransf_18
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_18