The domain within your query sequence starts at position 6 and ends at position 94; the E-value for the Methyltransf_1N domain shown below is 1.1e-21.
KMKYSVLDSPLGKMELSGCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQ CTAWLEAYFREPAATEGLPLPALHHPVFQ
Methyltransf_1N |
 |
|---|
| PFAM accession number: | PF02870 |
|---|---|
| Interpro abstract (IPR008332): | Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase ( EC 2.1.1.63 ). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme [ (PUBMED:3052269) ]. This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources [ (PUBMED:1579490) ]. This group of proteins are characterised by having an N-terminal ribonuclease-like domain associated with 6-O-methylguanine DNA methyltransferase activity ( IPR001497 ). |
| GO process: | DNA repair (GO:0006281) |
| GO function: | methylated-DNA-[protein]-cysteine S-methyltransferase activity (GO:0003908) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_1N